PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010557328.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family GATA
Protein Properties Length: 296aa    MW: 32733.8 Da    PI: 9.262
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010557328.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA64.11.6e-20215249135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++C ttkTp+WR+gp+g+ktLCnaCG+++r+ +l
  XP_010557328.1 215 CTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRL 249
                     *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.242209245IPR000679Zinc finger, GATA-type
SMARTSM004012.9E-18209259IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.65E-15213272No hitNo description
Gene3DG3DSA:3.30.50.102.3E-15213246IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.33E-18214271No hitNo description
PROSITE patternPS003440215240IPR000679Zinc finger, GATA-type
PfamPF003202.5E-18215249IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MNNGSWLPEV DFQGLSDDFF DDLMNHIDFP LEDVESGNGE GDWDAGFQGL EPPLMDMFST  60
LSSGLKRGGV SKSSGVADQK PIPILKQSTN SSESSSVMDS SVHQFEVKVS KLFQSSSPVS  120
VLENSSSSIS SQSSRSQGLS FPVVKGMRTK RKRPSALKLR LLLPFEPEHF SPDESESEVH  180
FPSEKPDKKK RKKQKIHPAR ASSEPKSTEG TMRKCTHCET TKTPQWREGP NGPKTLCNAC  240
GVRFRSGRLV PEYRPAASPT FIPSVHSNSH RKIVEIRRTK QFAQDTGLIH TVTSQA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1188192KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010557333.10.0PREDICTED: GATA transcription factor 11-like
RefseqXP_010557332.10.0PREDICTED: GATA transcription factor 11-like
RefseqXP_010557331.10.0PREDICTED: GATA transcription factor 11-like
RefseqXP_010557330.10.0PREDICTED: GATA transcription factor 11-like
RefseqXP_010557329.10.0PREDICTED: GATA transcription factor 11-like
RefseqXP_010557328.10.0PREDICTED: GATA transcription factor 11-like
SwissprotQ6DBP81e-112GAT11_ARATH; GATA transcription factor 11
TrEMBLV4M8B91e-116V4M8B9_EUTSA; Uncharacterized protein
STRINGBra018665.1-P1e-114(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-92GATA transcription factor 11